Fam38b antibody

Author: fqhz

August undefined, 2024

WebJul 5, 2024 · The membranes were blocked with 5% non-fat milk for 1 h at room temperature before being probed with rabbit anti-Epac1 antibody (1:1000, ab109415, Abcam, Cambridge, UK) or polyclonal rabbit anti−human Piezo2/FAM38B antibody (1:1000, LS-C180179, LSBio, Seattle, US) or rabbit anti-HTR3A antibody (1:500, 10443-1-AP, … WebThe PIEZO2 / FAM38B Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody to PIEZO2. This antibody recognizes Human, and Mouse antigen. The …

PIEZO2 Antibody - BSA Free (NBP1-78624): Novus Biologicals

WebMar 21, 2024 · Antibodies Protein products Assay products Protein details for PIEZO1 Gene (UniProtKB/Swiss-Prot) Protein Symbol: Q92508-PIEZ1_HUMAN Recommended name: Piezo-type mechanosensitive ion channel component 1 Protein Accession: Q92508 WebAnti-PIEZO2 antibody produced in rabbit (Anti-C18orf30 ); Prestige Antibodies Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution; Suitable … dr andrew bausch allentown

Anti-PIEZO2 / FAM38B Antibody Rabbit anti-Human …

WebPiezo2 (FAM38B) is a mechanosensitive ion channel which responds to mechanically activated currents in bladder, colon, lung, and dorsal root ganglia. This suggests Piezo2 is important for somatasensory … Web$516.00 / Each Description PIEZO2 Polyclonal antibody specifically detects PIEZO2 in Human, Mouse, Rat, Guinea Pig samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin). Specifications For Research Use Only WebFAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical … dr andrew beach

Anti-PIEZO2 / FAM38B Antibody Rabbit anti-Human Polyclonal

WebView Rabbit Polyclonal anti-PIEZO2 Antibody [HRP] (NBP1-78624H). Validated Applications: WB, IHC, IHC-P. Validated Species: Human, Mouse, Rat + more. Skip to main content. Items in Cart (0) ... Piezo2 (FAM38B) is a mechanosensitive ion channel which responds to mechanically activated currents in bladder, colon, lung, and dorsal root … WebThis FAM38B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2575-2604 amino acids of human FAM38B. Dilution : WB~~1:1000: Format : Purified polyclonal antibody … emotion tracking logWeb(ab244349) Anti-PIEZO2 antibody - Abcam - CiteAb. A rabbit polyclonal antibody, raised against Piezo-type mechanosensitive ion channel component 2 (Human), supplied by Abcam. Menu ... Protein FAM38B, PIEZ2_HUMAN. UniProt Code History B7Z812, M4GPJ9, Q6ZS91, Q8N787, Q8NAR6, Q9H5I5, Q9H5R4. dr andrew bean

"WebPrimary Anti-FAM38A/PIEZO1 antibody [EPR23826-103] (ab259949) View more associated products Overview Product name Anti-PIEZO2 antibody Description Rabbit polyclonal to PIEZO2 Host species Rabbit Tested applications Suitable for: IHC-P more details Species reactivity Reacts with: Human Immunogen " - Fam38b antibody

Fam38b antibody

WebC18orf30, C18orf58, FAM38B, FAM38B2, FLJ23144, FLJ23403, FLJ34907, HsT748, HsT771 . The protein encoded by this gene contains more than thirty transmembrane domains and likely functions as part of mechanically-activated (MA) cation channels. These channels serve to connect mechanical forces to biological signals. ... 223 antibodies … WebFAM38B is a multi-pass membrane proteinPotential. It belongs to the FAM38 family. Sequence Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS Physical form Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% …

Did you know?

WebAnti-FAM38B antibody, Internal (GTX46024) GeneTex Back Primary Antibodies Secondary Antibodies Antibody Panels ELISA Antibody Pairs & Kits Isotype Controls Proteins & Peptides Slides Lysates Serums … WebAnti-FAM38B antibody, Internal (GTX46024) GeneTex. Back. Primary Antibodies. Secondary Antibodies. Antibody Panels. ELISA Antibody Pairs & Kits. Isotype Controls. Proteins & Peptides.

WebThe PIEZO2 / FAM38B Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody to PIEZO2. This antibody recognizes Human, and Mouse antigen. The PIEZO2 / FAM38B Antibody has been validated for the following applications: Immunocytochemistry, Immunohistochemistry, Immunohistochemistry - fixed, and Western Blot. WebRabbit Polyclonal PIEZO2 antibody AA 162-211 for WB. Order anti-PIEZO2 antibody ABIN6752557. language English local_shipping United States phone+1 877 302 8632; Contact; person Login favorite_border Comparison List shopping_cart Basket menu; north; arrow_back. search. search. Phone: +1 877 302 8632 Fax: ...

WebPrestige Antibodies ® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible … WebFAM38B antibody LS-C180178 is an unconjugated rabbit polyclonal antibody to FAM38B (PIEZO2) from human. It is reactive with human and mouse. Validated for ICC and IHC.

WebPIEZO2 antibody (ABIN635249). Validated for WB. Tested in Human, Mouse, Rat. Order online. English +1 877 302 8632; Contact; Login Comparison List Basket Phone: +1 877 302 8632 Fax: +1 888 205 9894 (Toll-free) E-Mail: [email protected]. Home …

WebBackground. Coming from the Greek ''piesi'' and meaning "pressure", PIEZO2 is integral to the membrane and is involved in ion channel activity, cation channel activity and the regulation of membrane potential. Having between 24 and 36 transmembrane domains, PIEZO's are big transmembrane proteins found in a variety of species. emotion trumps reasonWebFAM38B antibody LS-C180179 is an unconjugated rabbit polyclonal antibody to FAM38B (PIEZO2) from human. It is reactive with human and mouse. Validated for ICC, IHC and … emotion tieWebRabbit polyclonal antibody to Piezo1. Compare Products ; Buying Guide; Scientific Support; Distributors; About Us; Contact Us; Skip to Content. Toggle Nav. My Cart Checkout +44 (0)1223 859 353 [email protected]. Currency ($) US Dollar ... anti-Protein FAM38A antibody, anti-Protein FAM38B antibody, ... dr andrew bean dermatology